Solution structure of c-terminal rage (ctrage)
PDB DOI: 10.2210/pdb2lmb/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2011-11-29 Deposition Author(s): Burz, D.S. , Maldonado, A.Y. , Rai, V. , Reverdatto, S. , Schmidt, A. , Shekhtman, A.
Solution structure of c-terminal rage (ctrage)
Burz, D.S. , Maldonado, A.Y. , Rai, V. , Reverdatto, S. , Schmidt, A. , Shekhtman, A.
Primary Citation of Related Structures: 2LMB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Advanced glycosylation end product-specific receptor | A | 43 | Homo Sapiens | MWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP |
Method: SOLUTION NMR
Deposited Date: 2011-11-29 Deposition Author(s): Burz, D.S. , Maldonado, A.Y. , Rai, V. , Reverdatto, S. , Schmidt, A. , Shekhtman, A.