Solution structure of the zn(ii) form of desulforedoxin
PDB DOI: 10.2210/pdb2lk5/pdb
Classification: ELECTRON TRANSPORT Organism(s): Desulfovibrio Gigas
Deposited: 2011-10-06 Deposition Author(s): Czaja, C. , Goodfellow, B.J. , Legall, J. , Moura, I. , Moura, J.J.G. , Romao, M.J. , Rusnak, F. , Tavares, P.
Solution structure of the zn(ii) form of desulforedoxin
Czaja, C. , Goodfellow, B.J. , Legall, J. , Moura, I. , Moura, J.J.G. , Romao, M.J. , Rusnak, F. , Tavares, P.
Primary Citation of Related Structures: 2LK5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Desulforedoxin | A | 36 | Desulfovibrio Gigas | ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
Desulforedoxin | B | 36 | Desulfovibrio Gigas | ANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
Method: SOLUTION NMR
Deposited Date: 2011-10-06 Deposition Author(s): Czaja, C. , Goodfellow, B.J. , Legall, J. , Moura, I. , Moura, J.J.G. , Romao, M.J. , Rusnak, F. , Tavares, P.