Structure of the influenza am2-bm2 chimeric channel
PDB DOI: 10.2210/pdb2ljb/pdb
Classification: TRANSPORT PROTEIN Organism(s): Paenibacillus Xerothermodurans
Deposited: 2011-09-10 Deposition Author(s): Chou, J.J. , Oxenoid, K. , Pielak, R.M.
Structure of the influenza am2-bm2 chimeric channel
Chou, J.J. , Oxenoid, K. , Pielak, R.M.
Primary Citation of Related Structures: 2LJB
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
M2 protein, BM2 protein chimera | A | 35 | Paenibacillus Xerothermodurans | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
M2 protein, BM2 protein chimera | B | 35 | Paenibacillus Xerothermodurans | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
M2 protein, BM2 protein chimera | C | 35 | Paenibacillus Xerothermodurans | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
M2 protein, BM2 protein chimera | D | 35 | Paenibacillus Xerothermodurans | RSNDSSDPLVVAASIIGILHFIAWTIGHLNQIKRG |
Method: SOLUTION NMR
Deposited Date: 2011-09-10 Deposition Author(s): Chou, J.J. , Oxenoid, K. , Pielak, R.M.