Solution structure and dna-binding properties of the phosphoesterase domain of dna ligase d
PDB DOI: 10.2210/pdb2lj6/pdb
Classification: DNA BINDING PROTEIN Organism(s): Pseudomonas Aeruginosa
Deposited: 2011-09-06 Deposition Author(s): Dutta, K. , Ghose, R. , Natarajan, A. , Shuman, S.
Solution structure and dna-binding properties of the phosphoesterase domain of dna ligase d
Dutta, K. , Ghose, R. , Natarajan, A. , Shuman, S.
Primary Citation of Related Structures: 2LJ6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable ATP-dependent DNA ligase | A | 177 | Pseudomonas Aeruginosa | MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLKSWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPREGLEKGHLSFALDGEKLSGRWHLIRTNLRGKQSQWFLVKAKDGEARSLDRFDVLKER |
Method: SOLUTION NMR
Deposited Date: 2011-09-06 Deposition Author(s): Dutta, K. , Ghose, R. , Natarajan, A. , Shuman, S.