2LI8
The solution structure of the lin28-znf domains bound to aggagau of pre-let-7 mirna
PDB DOI: 10.2210/pdb2li8/pdb
Classification: TRANSCRIPTION/RNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-08-25 Deposition Author(s): Allain, F.H.-T. , Loughlin, F.E.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
The solution structure of the lin28-znf domains bound to aggagau of pre-let-7 mirna
Allain, F.H.-T. , Loughlin, F.E.
Primary Citation of Related Structures: 2LI8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein lin-28 homolog A | A | 74 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSGLVPRGSHMPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQG |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA (5'-R(*AP*GP*GP*AP*GP*AP*U)-3') | b | 7 | NA | AGGAGAU |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2011-08-25 Deposition Author(s): Allain, F.H.-T. , Loughlin, F.E.