Solution structure of venturia inaequalis cellophane-induced 1 protein (vicin1) domains 1 and 2
PDB DOI: 10.2210/pdb2lht/pdb
Classification: CELL ADHESION Organism(s): Venturia Inaequalis
Deposited: 2011-08-16 Deposition Author(s): Dingley, A.J. , Greenwood, D.R. , Mcgillivray, D.J. , Mesarich, C.H. , Schmitz, M. , Templeton, M.D. , Tremouilhac, P.
Solution structure of venturia inaequalis cellophane-induced 1 protein (vicin1) domains 1 and 2
Dingley, A.J. , Greenwood, D.R. , Mcgillivray, D.J. , Mesarich, C.H. , Schmitz, M. , Templeton, M.D. , Tremouilhac, P.
Primary Citation of Related Structures: 2LHT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cellophane-induced protein 1 | A | 122 | Venturia Inaequalis | ADVFDPPTQYGYDGKPLDASFCRTAGSREKDCRKDVQACDKKYDDQGRETACAKGIREKYKPAVVYGYDGKPLDLGFCTLAGIREVDCRKDAQTCDKKYESDKCLNAIKEKYKPVVDPNPPA |
Method: SOLUTION NMR
Deposited Date: 2011-08-16 Deposition Author(s): Dingley, A.J. , Greenwood, D.R. , Mcgillivray, D.J. , Mesarich, C.H. , Schmitz, M. , Templeton, M.D. , Tremouilhac, P.