Solution structure of staphylococcus aureus isdh linker domain
PDB DOI: 10.2210/pdb2lhr/pdb
Classification: METAL TRANSPORT Organism(s): Staphylococcus Aureus Subsp. Aureus
Deposited: 2011-08-12 Deposition Author(s): Clubb, R.T. , Malmirchegini, G.R. , Robson, S.A. , Spirig, T.
Solution structure of staphylococcus aureus isdh linker domain
Clubb, R.T. , Malmirchegini, G.R. , Robson, S.A. , Spirig, T.
Primary Citation of Related Structures: 2LHR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Iron-regulated surface determinant protein H | A | 78 | Staphylococcus Aureus Subsp. Aureus | SDDYVDEETYNLQKLLAPYHKAKTLERQVYELEKLQEKLPEKYKAEYKKKLDQTRVELADQVKSAVTEFENVTPTNDQ |
Method: SOLUTION NMR
Deposited Date: 2011-08-12 Deposition Author(s): Clubb, R.T. , Malmirchegini, G.R. , Robson, S.A. , Spirig, T.