Structure of bacteriophage spp1 gp17 protein
PDB DOI: 10.2210/pdb2lfp/pdb
Classification: VIRAL PROTEIN Organism(s): Bacillus Phage Spp1
Deposited: 2011-07-07 Deposition Author(s): Auzat, I. , Chagot, B. , Gallopin, M. , Gilquin, B. , Petitpas, I. , Tavares, P. , Zinn-Justin, S.
Structure of bacteriophage spp1 gp17 protein
Auzat, I. , Chagot, B. , Gallopin, M. , Gilquin, B. , Petitpas, I. , Tavares, P. , Zinn-Justin, S.
Primary Citation of Related Structures: 2LFP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bacteriophage SPP1 complete nucleotide sequence | A | 139 | Bacillus Phage Spp1 | QGLQTWKLASRALQKATVENLESYQPLMEMVNQVTESPGKDDPYPYVVIGDQSSTPFETKSSFGENITMDFHVWGGTTRAEAQDISSRVLEALTYKPLMFEGFTFVAKKLVLAQVITDTDGVTKHGIIKVRFTINNNTG |
Method: SOLUTION NMR
Deposited Date: 2011-07-07 Deposition Author(s): Auzat, I. , Chagot, B. , Gallopin, M. , Gilquin, B. , Petitpas, I. , Tavares, P. , Zinn-Justin, S.