Structural plasticity of paneth cell alpha-defensins: characterization of salt-bridge deficient analogues of mouse cryptdin-4
PDB DOI: 10.2210/pdb2lew/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Enterobacter Aerogenes
Deposited: 2011-06-24 Deposition Author(s): Andersson, H.S. , Bengtsson, E. , Craik, D.J. , Daly, N.L. , Haugaard-Kedstrom, L.M. , Rosengren, K.
Structural plasticity of paneth cell alpha-defensins: characterization of salt-bridge deficient analogues of mouse cryptdin-4
Andersson, H.S. , Bengtsson, E. , Craik, D.J. , Daly, N.L. , Haugaard-Kedstrom, L.M. , Rosengren, K.
Primary Citation of Related Structures: 2LEW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Alpha-defensin 4 | A | 32 | Enterobacter Aerogenes | GLLCYCRKGHCKRGGRVRGTCGIRFLYCCPRR |
Method: SOLUTION NMR
Deposited Date: 2011-06-24 Deposition Author(s): Andersson, H.S. , Bengtsson, E. , Craik, D.J. , Daly, N.L. , Haugaard-Kedstrom, L.M. , Rosengren, K.