Structure of the ww domain of pin1 in complex with a human phosphorylated smad3 derived peptide
PDB DOI: 10.2210/pdb2lb3/pdb
Classification: SIGNALING PROTEIN/TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Method: SOLUTION NMR Resolution: N.A.
Structure of the ww domain of pin1 in complex with a human phosphorylated smad3 derived peptide
Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Primary Citation of Related Structures: 2LB3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 36 | Homo Sapiens , Synthetic Construct | KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNS |
Mothers against decapentaplegic homolog 2 | B | 8 | Homo Sapiens , Synthetic Construct | IPETPPPG |
Method: SOLUTION NMR
Deposited Date: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.