2LB2
Structure of the second domain of human nedd4l in complex with a phosphorylated ptpy motif derived from human smad3
PDB DOI: 10.2210/pdb2lb2/pdb
Classification: SIGNALING PROTEIN/TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the second domain of human nedd4l in complex with a phosphorylated ptpy motif derived from human smad3
Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Primary Citation of Related Structures: 2LB2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4-like | A | 35 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL |
| Mothers against decapentaplegic homolog 3 | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ETPPPGYLSEDG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.