Structure of the first ww domain of human smurf1 in complex with a di-phosphorylated human smad1 derived peptide
PDB DOI: 10.2210/pdb2lb0/pdb
Classification: SIGNALING PROTEIN/TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Structure of the first ww domain of human smurf1 in complex with a di-phosphorylated human smad1 derived peptide
Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Primary Citation of Related Structures: 2LB0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase SMURF1 | A | 36 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRI |
Mothers against decapentaplegic homolog 1 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSSDPGSPFQ |
Method: SOLUTION NMR
Deposited Date: 2011-03-22 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.