2LAJ
Third ww domain of human nedd4l in complex with doubly phosphorylated human smad3 derived peptide
PDB DOI: 10.2210/pdb2laj/pdb
Classification: LIGASE/TRANSCRIPTION REGULATOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2011-03-16 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Third ww domain of human nedd4l in complex with doubly phosphorylated human smad3 derived peptide
Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.
Primary Citation of Related Structures: 2LAJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4-like | A | 44 | Homo Sapiens , Synthetic Construct | GAMEQSFLPPGWEMRIAPNGRPFFYDHNTKTTTWEDPRLKFPVH |
| Mothers against decapentaplegic homolog 3 | B | 10 | Homo Sapiens , Synthetic Construct | AGSPNLSPNP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2011-03-16 Deposition Author(s): Aragon, E. , Escobedo, A. , Goerner, N. , Macias, M.J. , Massague, J. , Xi, Q. , Zaromytidou, A.