Solution structure of chr148 from cytophaga hutchinsonii, northeast structural genomics consortium target chr148
PDB DOI: 10.2210/pdb2l8o/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Cytophaga Hutchinsonii Atcc 33406
Deposited: 2011-01-21 Deposition Author(s): Acton, T. , Ciccosanti, C. , Everett, J. , Lee, D. , Liu, Y. , Montelione, G. , Nair, L. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J. , Rost, B. , Xiao, R.
Solution structure of chr148 from cytophaga hutchinsonii, northeast structural genomics consortium target chr148
Acton, T. , Ciccosanti, C. , Everett, J. , Lee, D. , Liu, Y. , Montelione, G. , Nair, L. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J. , Rost, B. , Xiao, R.
Primary Citation of Related Structures: 2L8O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Activator of Hsp90 ATPase homologue 1-like C-terminal domain-containing protein | A | 144 | Cytophaga Hutchinsonii Atcc 33406 | GNKITVEVTVYAAIEKVWKYWNEPAHIMKWCQASPEWHVPAAQNDLKAGGTFTTTMAAKDGSMSFDFGGVYDQVKTNDLIEYTIGDGRKVRIVFTHTGDTTNIVESFDPEETNPRELQQSGWQAILNSFKSYTENNLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2011-01-21 Deposition Author(s): Acton, T. , Ciccosanti, C. , Everett, J. , Lee, D. , Liu, Y. , Montelione, G. , Nair, L. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J. , Rost, B. , Xiao, R.