Solution nmr structure of human amylin in sds micelles at ph 7.3
PDB DOI: 10.2210/pdb2l86/pdb
Classification: APOPTOSIS Organism(s): N.A.
Deposited: 2011-01-04 Deposition Author(s): Brender, J.R. , Nanga, R. , Ramamoorthy, A. , Vivekanandan, S.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of human amylin in sds micelles at ph 7.3
Brender, J.R. , Nanga, R. , Ramamoorthy, A. , Vivekanandan, S.
Primary Citation of Related Structures: 2L86
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Islet amyloid polypeptide | A | 38 | N.A. | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYX |
Method: SOLUTION NMR
Deposited Date: 2011-01-04 Deposition Author(s): Brender, J.R. , Nanga, R. , Ramamoorthy, A. , Vivekanandan, S.