Solution nmr structure of conjugate transposon protein bvu_1572(27-141) from bacteroides vulgatus, northeast structural genomics consortium target bvr155
PDB DOI: 10.2210/pdb2l7q/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Bacteroides Vulgatus
Deposited: 2010-12-20 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Cort, J.R. , Everett, J.K. , Janjua, H. , Kennedy, M.A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Wang, D. , Xiao, R. , Yang, Y.
Solution nmr structure of conjugate transposon protein bvu_1572(27-141) from bacteroides vulgatus, northeast structural genomics consortium target bvr155
Acton, T.B. , Ciccosanti, C. , Cort, J.R. , Everett, J.K. , Janjua, H. , Kennedy, M.A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Wang, D. , Xiao, R. , Yang, Y.
Primary Citation of Related Structures: 2L7Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Conserved protein found in conjugate transposon | A | 124 | Bacteroides Vulgatus | MNELDIQQEYPFTVESMPVADEIAGDETVEIRLEIKPSGNFIGTVYTLRYFQPDGKGSLKMEDGTVLKPNDRYLLNEWKFRLYYTSQSDKEAQTIDLYFEDNWGNLQQLTYDFNGKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2010-12-20 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Cort, J.R. , Everett, J.K. , Janjua, H. , Kennedy, M.A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Wang, D. , Xiao, R. , Yang, Y.