New high resolution nmr structure of gpw (w protein of bacteriophage lambda) at neutral ph
PDB DOI: 10.2210/pdb2l6q/pdb
Classification: VIRAL PROTEIN Organism(s): Enterobacteria Phage Lambda
Deposited: 2010-11-24 Deposition Author(s): De Alba, E. , Munoz, V. , Sborgi, L. , Verma, A.
New high resolution nmr structure of gpw (w protein of bacteriophage lambda) at neutral ph
De Alba, E. , Munoz, V. , Sborgi, L. , Verma, A.
Primary Citation of Related Structures: 2L6Q
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Head-to-tail joining protein W (GpW) from bacteriophage origin | A | 62 | Enterobacteria Phage Lambda | MVRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRG |
Method: SOLUTION NMR
Deposited Date: 2010-11-24 Deposition Author(s): De Alba, E. , Munoz, V. , Sborgi, L. , Verma, A.