2L5E
Complex between bd1 of brd3 and gata-1 c-tail
PDB DOI: 10.2210/pdb2l5e/pdb
Classification: NUCLEAR PROTEIN/TRANSCRIPTION Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-10-31 Deposition Author(s): Blobel, G.A. , Gamsjaeger, R. , Lamonica, J.M. , Mackay, J.P. , Webb, S.R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Complex between bd1 of brd3 and gata-1 c-tail
Blobel, G.A. , Gamsjaeger, R. , Lamonica, J.M. , Mackay, J.P. , Webb, S.R.
Primary Citation of Related Structures: 2L5E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 3 | A | 128 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVEL |
| GATA-1 | B | 13 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KASGKGKKKRGSN |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-10-31 Deposition Author(s): Blobel, G.A. , Gamsjaeger, R. , Lamonica, J.M. , Mackay, J.P. , Webb, S.R.