Solution structure of the c-terminal domain of silb from cupriavidus metallidurans
PDB DOI: 10.2210/pdb2l55/pdb
Classification: METAL BINDING PROTEIN Organism(s): Cupriavidus Metallidurans
Deposited: 2010-10-25 Deposition Author(s): Bersch, B. , Derfoufi, K. , Vandenbussche, G.
Solution structure of the c-terminal domain of silb from cupriavidus metallidurans
Bersch, B. , Derfoufi, K. , Vandenbussche, G.
Primary Citation of Related Structures: 2L55
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SilB,Silver efflux protein, MFP component of the three components proton antiporter metal efflux system | A | 82 | Cupriavidus Metallidurans | GPEHRAVGRIQSIGERSLIIAHEAIPSAQWGAMTMEFAAPPAGLPQGLKAGDRVAFSFRLDPHGMATLVTVAPQVQTAGAKP |
Method: SOLUTION NMR
Deposited Date: 2010-10-25 Deposition Author(s): Bersch, B. , Derfoufi, K. , Vandenbussche, G.