Nmr structure in a membrane environment reveals putative amyloidogenic regions of the sevi precursor peptide pap248-286
PDB DOI: 10.2210/pdb2l3h/pdb
Classification: HYDROLASE Organism(s): N.A.
Deposited: 2010-09-13 Deposition Author(s): Brender, J. , Nanga, R. , Popovych, N. , Ramamoorthy, A. , Vivekanandan, S.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure in a membrane environment reveals putative amyloidogenic regions of the sevi precursor peptide pap248-286
Brender, J. , Nanga, R. , Popovych, N. , Ramamoorthy, A. , Vivekanandan, S.
Primary Citation of Related Structures: 2L3H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Prostatic acid phosphatase | A | 39 | N.A. | GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY |
Method: SOLUTION NMR
Deposited Date: 2010-09-13 Deposition Author(s): Brender, J. , Nanga, R. , Popovych, N. , Ramamoorthy, A. , Vivekanandan, S.