Solution nmr structure of the chromobox protein cbx7 with h3k27me3
PDB DOI: 10.2210/pdb2l1b/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2010-07-27 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Muhandiram, R. , Quang, H. , Structural Genomics Consortium (Sgc)
Solution nmr structure of the chromobox protein cbx7 with h3k27me3
Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Muhandiram, R. , Quang, H. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 2L1B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 7 | A | 56 | Homo Sapiens , Synthetic Construct | GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
| Histone H3 | B | 15 | Homo Sapiens , Synthetic Construct | QLATKAARKSAPATG |
Method: SOLUTION NMR
Deposited Date: 2010-07-27 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Muhandiram, R. , Quang, H. , Structural Genomics Consortium (Sgc)