2L1B
Solution nmr structure of the chromobox protein cbx7 with h3k27me3
PDB DOI: 10.2210/pdb2l1b/pdb
Classification: TRANSCRIPTION REGULATOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2010-07-27 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Muhandiram, R. , Quang, H. , Structural Genomics Consortium (Sgc)
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the chromobox protein cbx7 with h3k27me3
Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Muhandiram, R. , Quang, H. , Structural Genomics Consortium (Sgc)
Primary Citation of Related Structures: 2L1B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromobox protein homolog 7 | A | 56 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE |
| Histone H3 | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QLATKAARKSAPATG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-07-27 Deposition Author(s): Arrowsmith, C. , Edwards, A. , Fares, C. , Gutmanas, A. , Kaustov, L. , Lemak, A. , Loppnau, P. , Min, J. , Muhandiram, R. , Quang, H. , Structural Genomics Consortium (Sgc)