Solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g
PDB DOI: 10.2210/pdb2kyb/pdb
Classification: TOXIN Organism(s): Clostridium Perfringens
Deposited: 2010-05-21 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everrett, J.K. , Janjua, H. , Lee, D. , Lee, H. , Mobley, C.K. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Xiao, R.
Solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g
Acton, T.B. , Ciccosanti, C. , Everrett, J.K. , Janjua, H. , Lee, D. , Lee, H. , Mobley, C.K. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Xiao, R.
Primary Citation of Related Structures: 2KYB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase domain protein, possible enterotoxin | A | 60 | Clostridium Perfringens | MKTGIVNVSSSLNVRSSASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYI |
Method: SOLUTION NMR
Deposited Date: 2010-05-21 Deposition Author(s): Acton, T.B. , Ciccosanti, C. , Everrett, J.K. , Janjua, H. , Lee, D. , Lee, H. , Mobley, C.K. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J.H. , Xiao, R.