2KY3
Solution structure of gs-alfa-ktx5.4 synthetic scorpion like
PDB DOI: 10.2210/pdb2ky3/pdb
Classification: TOXIN Organism(s): Mesobuthus Tamulus
Deposited: 2010-05-14 Deposition Author(s): Brieba-De Castro, L. , Del Rio-Portilla, F. , Ramirez-Cordero, B.E.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of gs-alfa-ktx5.4 synthetic scorpion like
Brieba-De Castro, L. , Del Rio-Portilla, F. , Ramirez-Cordero, B.E.
Primary Citation of Related Structures: 2KY3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin alpha-KTx 5.4 | A | 33 | Mesobuthus Tamulus | GSAFCNLRRCELSCRSLGLLGKCIGEECKCVPY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2010-05-14 Deposition Author(s): Brieba-De Castro, L. , Del Rio-Portilla, F. , Ramirez-Cordero, B.E.