Solution structure of sur18c from streptococcus thermophilus. northeast structural genomics consortium target sur18c
PDB DOI: 10.2210/pdb2kxy/pdb
Classification: Structural Genomics, Unknown function Organism(s): Streptococcus Thermophilus
Deposited: 2010-05-13 Deposition Author(s): Acton, T. , Belote, R. , Ciccosanti, C. , Everett, J. , Hamilton, K. , Lee, H. , Liu, Y. , Montelione, G. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J. , Xiao, R.
Solution structure of sur18c from streptococcus thermophilus. northeast structural genomics consortium target sur18c
Acton, T. , Belote, R. , Ciccosanti, C. , Everett, J. , Hamilton, K. , Lee, H. , Liu, Y. , Montelione, G. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J. , Xiao, R.
Primary Citation of Related Structures: 2KXY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein | A | 100 | Streptococcus Thermophilus | KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQPSTVKVNLKVTQKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2010-05-13 Deposition Author(s): Acton, T. , Belote, R. , Ciccosanti, C. , Everett, J. , Hamilton, K. , Lee, H. , Liu, Y. , Montelione, G. , Northeast Structural Genomics Consortium (Nesg) , Prestegard, J. , Xiao, R.