Solution structure of the par toxin fst in dpc micelles
PDB DOI: 10.2210/pdb2kv5/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2010-03-08 Deposition Author(s): Gobl, C. , Kosol, S. , Ruckert, H.M. , Zangger, K.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the par toxin fst in dpc micelles
Gobl, C. , Kosol, S. , Ruckert, H.M. , Zangger, K.
Primary Citation of Related Structures: 2KV5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative uncharacterized protein RNAI | A | 33 | N.A. | MKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK |
Method: SOLUTION NMR
Deposited Date: 2010-03-08 Deposition Author(s): Gobl, C. , Kosol, S. , Ruckert, H.M. , Zangger, K.