Solution structure of sugarcane defensin 5
PDB DOI: 10.2210/pdb2ksk/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Saccharum Officinarum
Deposited: 2010-01-06 Deposition Author(s): Almeida, F.C.L. , De Paula, V.S. , Valente, A.
Solution structure of sugarcane defensin 5
Almeida, F.C.L. , De Paula, V.S. , Valente, A.
Primary Citation of Related Structures: 2KSK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sugarcane defensin 5 | A | 71 | Saccharum Officinarum | HTPTPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKRERAAATLRWPGL |
Method: SOLUTION NMR
Deposited Date: 2010-01-06 Deposition Author(s): Almeida, F.C.L. , De Paula, V.S. , Valente, A.