Nmr structure of the sea anemone actinoporin sticholysin
PDB DOI: 10.2210/pdb2ks4/pdb
Classification: TRANSPORT PROTEIN Organism(s): Stichodactyla Helianthus
Deposited: 2009-12-29 Deposition Author(s): Bruix, M. , Castrillo, I. , Santoro, J.
Nmr structure of the sea anemone actinoporin sticholysin
Bruix, M. , Castrillo, I. , Santoro, J.
Primary Citation of Related Structures: 2KS4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sticholysin-1 | A | 176 | Stichodactyla Helianthus | SELAGTIIDGASLTFEVLDKVLGELGKVSRKIAVGIDNESGGTWTALNAYFRSGTTDVILPEVVPNTKALLYSGRKSSGPVATGAVAAFAYYMSNGNTLGVMFSVPFDYNWYSNWWDVKIYPGKRRADQGMYEDMYYGNPYRGDNGWYQKNLGYGLRMKGIMTSAGEAKMQIKISR |
Method: SOLUTION NMR
Deposited Date: 2009-12-29 Deposition Author(s): Bruix, M. , Castrillo, I. , Santoro, J.