Solution structure of mast205-pdz complexed with the c-terminus of a rabies virus g protein
PDB DOI: 10.2210/pdb2kqf/pdb
Classification: SIGNALING PROTEIN/PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-11-04 Deposition Author(s): Bernard, A. , Cordier, F. , Delepierre, M. , Lafon, M. , Simenel, C. , Terrien, E. , Wolff, N.
Solution structure of mast205-pdz complexed with the c-terminus of a rabies virus g protein
Bernard, A. , Cordier, F. , Delepierre, M. , Lafon, M. , Simenel, C. , Terrien, E. , Wolff, N.
Primary Citation of Related Structures: 2KQF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Microtubule-associated serine/threonine-protein kinase 2 | A | 96 | Homo Sapiens , Synthetic Construct | GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTPLEN |
| C-terminal motif from Glycoprotein | B | 13 | Homo Sapiens , Synthetic Construct | SWESHKSGGETRL |
Method: SOLUTION NMR
Deposited Date: 2009-11-04 Deposition Author(s): Bernard, A. , Cordier, F. , Delepierre, M. , Lafon, M. , Simenel, C. , Terrien, E. , Wolff, N.