2KQ0
Human nedd4 3rd ww domain complex with ebola zaire virus matrix protein vp40 derived peptide ilptappeymea
PDB DOI: 10.2210/pdb2kq0/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-10-23 Deposition Author(s): Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Human nedd4 3rd ww domain complex with ebola zaire virus matrix protein vp40 derived peptide ilptappeymea
Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.
Primary Citation of Related Structures: 2KQ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 49 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMGPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAH |
| 12-mer from Matrix protein VP40 | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ILPTAPPEYMEA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-10-23 Deposition Author(s): Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.