Human nedd4 3rd ww domain complex with ebola zaire virus matrix protein vp40 derived peptide ilptappeymea
PDB DOI: 10.2210/pdb2kq0/pdb
Classification: LIGASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-10-23 Deposition Author(s): Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.
Human nedd4 3rd ww domain complex with ebola zaire virus matrix protein vp40 derived peptide ilptappeymea
Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.
Primary Citation of Related Structures: 2KQ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 49 | Homo Sapiens , Synthetic Construct | GAMGPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAH |
| 12-mer from Matrix protein VP40 | B | 12 | Homo Sapiens , Synthetic Construct | ILPTAPPEYMEA |
Method: SOLUTION NMR
Deposited Date: 2009-10-23 Deposition Author(s): Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.