Solution nmr structure of streptomyces coelicolor sco3027 modeled with zn+2 bound, northeast structural genomics consortium target rr58
PDB DOI: 10.2210/pdb2kpi/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Streptomyces Coelicolor
Deposited: 2009-10-15 Deposition Author(s): Arrowmith, C.H. , Cort, J.R. , Garcia, M. , Kennedy, M.A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Yee, A.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of streptomyces coelicolor sco3027 modeled with zn+2 bound, northeast structural genomics consortium target rr58
Arrowmith, C.H. , Cort, J.R. , Garcia, M. , Kennedy, M.A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Yee, A.
Primary Citation of Related Structures: 2KPI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein SCO3027 | A | 56 | Streptomyces Coelicolor | MPLEAGLLEILACPACHAPLEERDAELICTGQDCGLAYPVRDGIPVLLVDEARRPE |
Method: SOLUTION NMR
Deposited Date: 2009-10-15 Deposition Author(s): Arrowmith, C.H. , Cort, J.R. , Garcia, M. , Kennedy, M.A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ramelot, T.A. , Yee, A.