2KO0
Solution structure of the thap zinc finger of thap1 in complex with its dna target
PDB DOI: 10.2210/pdb2ko0/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-09-08 Deposition Author(s): Campagne, S. , Gervais, V. , Milon, A. , Saurel, O.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the thap zinc finger of thap1 in complex with its dna target
Campagne, S. , Gervais, V. , Milon, A. , Saurel, O.
Primary Citation of Related Structures: 2KO0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| THAP domain-containing protein 1 | A | 87 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDSFKRESNNKLLKENAVPTIFLELVPR |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-09-08 Deposition Author(s): Campagne, S. , Gervais, V. , Milon, A. , Saurel, O.