Isolation and characterization of peptides from momordica cochinchinensis seeds.
PDB DOI: 10.2210/pdb2knp/pdb
Classification: UNKNOWN FUNCTION Organism(s): Momordica Cochinchinensis
Deposited: 2009-08-30 Deposition Author(s): Chan, L. , Daly, N.L.
Isolation and characterization of peptides from momordica cochinchinensis seeds.
Primary Citation of Related Structures: 2KNP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MCoCC-1 | A | 33 | Momordica Cochinchinensis | GCEGKQCGLFRSCGGGCRCWPTVTPGVGICSSS |
Method: SOLUTION NMR
Deposited Date: 2009-08-30 Deposition Author(s): Chan, L. , Daly, N.L.