Solution structure of zinc-substituted rubredoxin b (rv3250c) from mycobacterium tuberculosis. seattle structural genomics center for infectious disease target mytud.01635.a
PDB DOI: 10.2210/pdb2kn9/pdb
Classification: ELECTRON TRANSPORT Organism(s): Mycobacterium Tuberculosis
Deposited: 2009-08-20 Deposition Author(s): Buchko, G.W. , Hewitt, S.N. , Napuli, A.J. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Van Voorhis, W.C.
Solution structure of zinc-substituted rubredoxin b (rv3250c) from mycobacterium tuberculosis. seattle structural genomics center for infectious disease target mytud.01635.a
Buchko, G.W. , Hewitt, S.N. , Napuli, A.J. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Van Voorhis, W.C.
Primary Citation of Related Structures: 2KN9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Rubredoxin | A | 81 | Mycobacterium Tuberculosis | MAHHHHHHMGTLEAQTQGPGSMNDYKLFRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKSDFEMVEVARS |
Method: SOLUTION NMR
Deposited Date: 2009-08-20 Deposition Author(s): Buchko, G.W. , Hewitt, S.N. , Napuli, A.J. , Seattle Structural Genomics Center For Infectious Disease (Ssgcid) , Van Voorhis, W.C.