2KKF
Solution structure of mll cxxc domain in complex with palindromic cpg dna
PDB DOI: 10.2210/pdb2kkf/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-06-18 Deposition Author(s): Bushweller, J.H. , Cierpicki, T. , Grembecka, J.E. , Lukasik, S.M. , Omonkowska, M. , Popovic, R. , Riesbeck, J.E. , Shultis, D.S. , Zeleznik-Le, N.J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of mll cxxc domain in complex with palindromic cpg dna
Bushweller, J.H. , Cierpicki, T. , Grembecka, J.E. , Lukasik, S.M. , Omonkowska, M. , Popovic, R. , Riesbeck, J.E. , Shultis, D.S. , Zeleznik-Le, N.J.
Primary Citation of Related Structures: 2KKF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase HRX | A | 59 | Homo Sapiens , Synthetic Construct | GSKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSK |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2009-06-18 Deposition Author(s): Bushweller, J.H. , Cierpicki, T. , Grembecka, J.E. , Lukasik, S.M. , Omonkowska, M. , Popovic, R. , Riesbeck, J.E. , Shultis, D.S. , Zeleznik-Le, N.J.