Nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide
PDB DOI: 10.2210/pdb2kft/pdb
Classification: TRANSCRIPTION/PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2009-02-27 Deposition Author(s): Chakravarty, S. , Zeng, L. , Zhou, M.
Nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide
Chakravarty, S. , Zeng, L. , Zhou, M.
Primary Citation of Related Structures: 2KFT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Autoimmune regulator | A | 56 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE |
Histone H3 | B | 21 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKSTGGKAPRKQLC |
Method: SOLUTION NMR
Deposited Date: 2009-02-27 Deposition Author(s): Chakravarty, S. , Zeng, L. , Zhou, M.