Nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide
PDB DOI: 10.2210/pdb2kft/pdb
Classification: TRANSCRIPTION/PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-02-27 Deposition Author(s): Chakravarty, S. , Zeng, L. , Zhou, M.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide
Chakravarty, S. , Zeng, L. , Zhou, M.
Primary Citation of Related Structures: 2KFT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Autoimmune regulator | A | 56 | Homo Sapiens , Synthetic Construct | GSKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQE |
| Histone H3 | B | 21 | Homo Sapiens , Synthetic Construct | ARTKQTARKSTGGKAPRKQLC |
Method: SOLUTION NMR
Deposited Date: 2009-02-27 Deposition Author(s): Chakravarty, S. , Zeng, L. , Zhou, M.