Nmr structure of plasmid copy control protein orf56 from sulfolobus islandicus
PDB DOI: 10.2210/pdb2k9i/pdb
Classification: DNA BINDING PROTEIN Organism(s): Sulfolobus Islandicus
Deposited: 2008-10-15 Deposition Author(s): Balbach, J. , Weininger, U.
Nmr structure of plasmid copy control protein orf56 from sulfolobus islandicus
Primary Citation of Related Structures: 2K9I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Uncharacterized protein ORF56 | A | 55 | Sulfolobus Islandicus | GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK |
| Uncharacterized protein ORF56 | B | 55 | Sulfolobus Islandicus | GRPYKLLNGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHDKQKK |
Method: SOLUTION NMR
Deposited Date: 2008-10-15 Deposition Author(s): Balbach, J. , Weininger, U.