Deletions in a surface loop divert the folding of a protein domain into a metastable dimeric form
PDB DOI: 10.2210/pdb2k7v/pdb
Classification: TRANSFERASE Organism(s): Escherichia Coli
Deposited: 2008-08-27 Deposition Author(s): Jones, D.D. , Perham, R.N. , Stott, K.M. , Yusof, A.M.
Deletions in a surface loop divert the folding of a protein domain into a metastable dimeric form
Jones, D.D. , Perham, R.N. , Stott, K.M. , Yusof, A.M.
Primary Citation of Related Structures: 2K7V
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | A | 85 | Escherichia Coli | MVKEVNVPDIVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQE |
| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | B | 85 | Escherichia Coli | MVKEVNVPDIVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAAPAAAPAKQE |
Method: SOLUTION NMR
Deposited Date: 2008-08-27 Deposition Author(s): Jones, D.D. , Perham, R.N. , Stott, K.M. , Yusof, A.M.