Solution nmr structure of toxin-like potassium channel blocking domain in mmp23
PDB DOI: 10.2210/pdb2k72/pdb
Classification: HYDROLASE Organism(s): N.A.
Deposited: 2008-07-31 Deposition Author(s): Feng, Z. , Khoo, K.K. , Norton, R.S.
Solution nmr structure of toxin-like potassium channel blocking domain in mmp23
Feng, Z. , Khoo, K.K. , Norton, R.S.
Primary Citation of Related Structures: 2K72
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Matrix metalloproteinase-23 | A | 37 | N.A. | YGCLDRIFVCTSWARKGFCDVRQRLMKRLCPRSCDFC |
Method: SOLUTION NMR
Deposited Date: 2008-07-31 Deposition Author(s): Feng, Z. , Khoo, K.K. , Norton, R.S.