Nmr structures of the first transmembrane domain of the neuronal acetylcholine receptor beta 2 subunit
PDB DOI: 10.2210/pdb2k58/pdb
Classification: TRANSPORT PROTEIN Organism(s): N.A.
Deposited: 2008-06-25 Deposition Author(s): Bondarenko, V. , Tang, P. , Xu, Y.
Nmr structures of the first transmembrane domain of the neuronal acetylcholine receptor beta 2 subunit
Bondarenko, V. , Tang, P. , Xu, Y.
Primary Citation of Related Structures: 2K58
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Neuronal acetylcholine receptor subunit beta-2 | B | 35 | N.A. | RRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEK |
Method: SOLUTION NMR
Deposited Date: 2008-06-25 Deposition Author(s): Bondarenko, V. , Tang, P. , Xu, Y.