Solution structure of 30s ribosomal protein s27a from thermoplasma acidophilum
PDB DOI: 10.2210/pdb2k4x/pdb
Classification: RIBOSOMAL PROTEIN Organism(s): Thermoplasma Acidophilum
Deposited: 2008-06-20 Deposition Author(s): Arrowsmith, C. , Fares, C. , Lemak, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Semest, A. , Wu, B. , Yee, A.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of 30s ribosomal protein s27a from thermoplasma acidophilum
Arrowsmith, C. , Fares, C. , Lemak, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Semest, A. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 2K4X
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 30S ribosomal protein S27ae | A | 55 | Thermoplasma Acidophilum | MQKRELYEIADGKLVRKHRFCPRCGPGVFLAEHADRYSCGRCGYTEFKKAKKSKS |
Method: SOLUTION NMR
Deposited Date: 2008-06-20 Deposition Author(s): Arrowsmith, C. , Fares, C. , Lemak, A. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Semest, A. , Wu, B. , Yee, A.