Structural and functional characterization of tm ix of the nhe1 isoform of the na+/h+ exchanger
PDB DOI: 10.2210/pdb2k3c/pdb
Classification: METAL TRANSPORT Organism(s): N.A.
Deposited: 2008-05-01 Deposition Author(s): Ding, J. , Fliegel, L. , Li, X. , Rainey, J.K. , Reddy, T. , Sykes, B.D.
Structural and functional characterization of tm ix of the nhe1 isoform of the na+/h+ exchanger
Ding, J. , Fliegel, L. , Li, X. , Rainey, J.K. , Reddy, T. , Sykes, B.D.
Primary Citation of Related Structures: 2K3C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TMIX peptide | A | 33 | N.A. | XKSYMAYLSAELFHLSGIMALIASGVVMRPKKX |
Method: SOLUTION NMR
Deposited Date: 2008-05-01 Deposition Author(s): Ding, J. , Fliegel, L. , Li, X. , Rainey, J.K. , Reddy, T. , Sykes, B.D.