Solution structure of the reduced form of the n-terminal domain of pilb from n. meningitidis.
PDB DOI: 10.2210/pdb2jzs/pdb
Classification: ELECTRON TRANSPORT Organism(s): Neisseria Meningitidis Serogroup A
Deposited: 2008-01-15 Deposition Author(s): Averlant-Petit, M. , Beaufils, C. , Boschi-Muller, S. , Branlant, G. , Cung, M. , Neiers, F. , Quinternet, M. , Tsan, P.
Solution structure of the reduced form of the n-terminal domain of pilb from n. meningitidis.
Averlant-Petit, M. , Beaufils, C. , Boschi-Muller, S. , Branlant, G. , Cung, M. , Neiers, F. , Quinternet, M. , Tsan, P.
Primary Citation of Related Structures: 2JZS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptide methionine sulfoxide reductase msrA/msrB | A | 144 | Neisseria Meningitidis Serogroup A | MVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL |
Method: SOLUTION NMR
Deposited Date: 2008-01-15 Deposition Author(s): Averlant-Petit, M. , Beaufils, C. , Boschi-Muller, S. , Branlant, G. , Cung, M. , Neiers, F. , Quinternet, M. , Tsan, P.