Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
PDB DOI: 10.2210/pdb2jzb/pdb
Classification: TRANSFERASE/transcription Organism(s): Escherichia Coli , Yersinia Pseudotuberculosis
Deposited: 2008-01-02 Deposition Author(s): Prasch, S. , Roesch, P. , Schweimer, K.
Solution structure of the complex between e.coli nusa-ar2 and rnap-actd
Prasch, S. , Roesch, P. , Schweimer, K.
Primary Citation of Related Structures: 2JZB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA-directed RNA polymerase subunit alpha | A | 99 | Escherichia Coli , Yersinia Pseudotuberculosis | GPDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE |
| Transcription elongation protein nusA | B | 74 | Escherichia Coli , Yersinia Pseudotuberculosis | GPSLGDNKPADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNICWFGDEA |
Method: SOLUTION NMR
Deposited Date: 2008-01-02 Deposition Author(s): Prasch, S. , Roesch, P. , Schweimer, K.