Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1). rdc refined
PDB DOI: 10.2210/pdb2jy7/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2007-12-07 Deposition Author(s): Layfield, R. , Long, J.E. , Searle, M.S.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the ubiquitin associated (uba) domain of p62 (sqstm1). rdc refined
Layfield, R. , Long, J.E. , Searle, M.S.
Primary Citation of Related Structures: 2JY7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ubiquitin-binding protein p62 | A | 52 | Salmonella Enterica | GSPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH |
Method: SOLUTION NMR
Deposited Date: 2007-12-07 Deposition Author(s): Layfield, R. , Long, J.E. , Searle, M.S.