Nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627
PDB DOI: 10.2210/pdb2jxx/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2007-11-30 Deposition Author(s): Arrowsmith, C.H. , Butler, C. , Dhe-Paganon, S. , Doherty, R.S. , Edwards, A.M. , Fares, C. , Karra, M. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Srisailam, S. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Yee, A.
Nmr solution structure of ubiquitin-like domain of nfatc2ip. northeast structural genomics consortium target hr5627
Arrowsmith, C.H. , Butler, C. , Dhe-Paganon, S. , Doherty, R.S. , Edwards, A.M. , Fares, C. , Karra, M. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Srisailam, S. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Yee, A.
Primary Citation of Related Structures: 2JXX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NFATC2-interacting protein | A | 97 | Homo Sapiens | MGSSHHHHHHSSGLVPRGSTETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG |
Method: SOLUTION NMR
Deposited Date: 2007-11-30 Deposition Author(s): Arrowsmith, C.H. , Butler, C. , Dhe-Paganon, S. , Doherty, R.S. , Edwards, A.M. , Fares, C. , Karra, M. , Lemak, A. , Northeast Structural Genomics Consortium (Nesg) , Srisailam, S. , Structural Genomics Consortium (Sgc) , Weigelt, J. , Yee, A.