The solution structure of hcv ns4b(40-69)
PDB DOI: 10.2210/pdb2jxf/pdb
Classification: VIRAL PROTEIN, MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2007-11-19 Deposition Author(s): Montserret, R. , Penin, F.
Method: SOLUTION NMR Resolution: N.A.
The solution structure of hcv ns4b(40-69)
Primary Citation of Related Structures: 2JXF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Genome polyprotein | A | 30 | N.A. | QTNWQKLEVFWAKHMWNFISGIQYLAGLST |
Method: SOLUTION NMR
Deposited Date: 2007-11-19 Deposition Author(s): Montserret, R. , Penin, F.