2JWH
Structure of a glycosylphosphatidylinositol-anchored domain from a trypanosome variant surface glycoprotein
PDB DOI: 10.2210/pdb2jwh/pdb
Classification: Membrane Protein, Immune System Organism(s): Trypanosoma Brucei Brucei
Deposited: 2007-10-12 Deposition Author(s): Burke, D.F. , Carrington, M. , Eyres, I. , Jones, N.G. , Mott, H.R. , Mues, M. , Nietlispach, D. , Sharma, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of a glycosylphosphatidylinositol-anchored domain from a trypanosome variant surface glycoprotein
Burke, D.F. , Carrington, M. , Eyres, I. , Jones, N.G. , Mott, H.R. , Mues, M. , Nietlispach, D. , Sharma, R.
Primary Citation of Related Structures: 2JWH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Variant surface glycoprotein ILTAT 1.24 | A | 48 | Trypanosoma Brucei Brucei | GTKASKSGVPVTQTQTAGADTTAEKCKGKGEKDCKSPDCKWEGGTCKD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2007-10-12 Deposition Author(s): Burke, D.F. , Carrington, M. , Eyres, I. , Jones, N.G. , Mott, H.R. , Mues, M. , Nietlispach, D. , Sharma, R.